HORDB

ID: hor006768
Uniprot ID: Q8WN94
Protein name: Acyl-CoA-binding protein
Gene name: DBI
Organism: Oryctolagus cuniculus (Rabbit)
Family: ACBP family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Oryctolagus (genus), Leporidae (family), Lagomorpha (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0000062 fatty-acyl-CoA binding; GO:0008289 lipid binding; GO:0036042 long-chain fatty acyl-CoA binding; GO:0042802 identical protein binding
GO BP: GO:0036151 phosphatidylcholine acyl-chain remodeling; GO:1903060 negative regulation of protein lipidation; GO:2001140 positive regulation of phospholipid transport
GO CC: GO:0005575 cellular_component; GO:0005783 endoplasmic reticulum; GO:0005794 Golgi apparatus; GO:0032994 protein-lipid complex

Sequence: SQAEFEKAAEEVKNLKTKPADAEMLFIYSHYKQATVGDVNTERPGMLDLKGKAKWDAWNELKGTSKESAMRAYVDKVEELKQKYGI
Length: 86
Propeptide: MSQAEFEKAAEEVKNLKTKPADAEMLFIYSHYKQATVGDVNTERPGMLDLKGKAKWDAWNELKGTSKESAMRAYVDKVEELKQKYGI
Signal peptide: NA
Modification: T1 N-acetylserine;T7 N6-acetyllysine;T7 N6-succinyllysine;T16 N6-succinyllysine;T18 N6-acetyllysine;T28 Phosphotyrosine;T50 N6-acetyllysine;T54 N6-(2-hydroxyisobutyryl)lysine;T54 N6-acetyllysine;T54 N6-malonyllysine;T54 N6-succinyllysine;T76 N6-acetyllysi
Glycosylation: NA
Mutagenesis: NA

Function: Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor (By similarity).
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006768_AF2.pdb

hor006768_ESM.pdb

Mass:	1130044	Formula:	C435H687N115O135S3
Absent amino acids:	C	Common amino acids:	K
pI:	7.52	Basic residues:	16
Polar residues:	20	Hydrophobic residues:	27
Hydrophobicity:	-84.3	Boman Index:	-17930
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	64.77
Instability Index:	2206.98	Extinction Coefficient cystines:	16960
Absorbance 280nm:	199.53